A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10077
Swiss-prot Accession number	Q92097 (Sequence in FASTA format)
Description	Progonadoliberin-3 precursor (Progonadoliberin III) [Contains:Gonadoliberin-3 (Gonadoliberin III) (Luteinizing hormone-releasinghormone III) (LH-RH III) (Gonadotropin-releasing hormone III) (GnRHIII) (Luliberin III); GnRH-associated peptide 3 (GnRH-associatedpeptide III)] (Fragment).
Source organism	Oncorhynchus tschawytscha (Chinook salmon) (King salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	74 Amino acids
Molecular weight	8254
References	1  PubMed abstract 1587389
Domain Name	N/A
Hormone Name	Gonadoliberin-3
Mature Hormone Sequence	QHWSYGWLPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (16-25)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10224
Swiss-prot Accession number	Q91364 (Sequence in FASTA format)
Description	Prolactin-2 precursor (Prolactin II) (PRL-II).
Source organism	Oncorhynchus tschawytscha (Chinook salmon) (King salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	210 Amino acids
Molecular weight	23457
References	1  PubMed abstract 1308811
Domain Name	Hormone_1
Hormone Name	Prolactin-2
Mature Hormone Sequence	IGLSDLMERASQRSDKLHSLSTSLNKDLDSHFPPMGRVMMPRPSMCHTSSLQIPKDKEQALRVSENELISLARSLLLAWNDPLLLLSSEAPTLPHPSNGDISSKIRELQDYSKSLGDGLDILVNKMGPSSQYISLIPFKGGDLGNDKTSRLINFHFLMSCFRRDSHKIDSFLKVLRCRATKMRPETC
Position of mature hormone in Pre-Hormone protein	187 Residues from position (24-210)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10443
Swiss-prot Accession number	P17640 (Sequence in FASTA format)
Description	Pro-MCH 1 precursor [Contains: Neuropeptide-glutamic acid-valine (NEV)(Neuropeptide E-V); Melanin-concentrating hormone (MCH)].
Source organism	Oncorhynchus tschawytscha (Chinook salmon) (King salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the melanin-concentrating hormone family.
Tissue Specificity	Pituitary gland. Produced in neurons of lateral basal hypothalamus which project both to the brain and to the neural lobe of the pituitary gland from where MCH is released
Post translational modification	N/A
Function	Plays a role in skin pigmentation by antagonizing the action of melanotropin alpha. Induces melanin concentration within the melanophores. May participate in the control of the hypothalamo-pituitary adrenal gland axis by inhibiting the release of ACTH
Protein Length	132 Amino acids
Molecular weight	14657
References	1  PubMed abstract 2471200
Domain Name	N/A
Hormone Name	Melanin-concentrating hormone
Mature Hormone Sequence	DTMRCMVGRVYRPCWEV
Position of mature hormone in Pre-Hormone protein	17 Residues from position (116-132)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10501
Swiss-prot Accession number	P69156 (Sequence in FASTA format)
Description	Pro-MCH 2 precursor [Contains: Neuropeptide-glutamic acid-valine (NEV)(Neuropeptide E-V); Melanin-concentrating hormone (MCH)].
Source organism	Oncorhynchus tschawytscha (Chinook salmon) (King salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the melanin-concentrating hormone family.
Tissue Specificity	Pituitary gland. Produced in neurons of lateral basal hypothalamus which project both to the brain and to the neural lobe of the pituitary gland from where MCH is released
Post translational modification	N/A
Function	N/A
Protein Length	132 Amino acids
Molecular weight	14710
References	1  PubMed abstract 2471200
Domain Name	N/A
Hormone Name	Neuropeptide-glutamic acid-valine
Mature Hormone Sequence	EADQDLSPSISIV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (101-113)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10502
Swiss-prot Accession number	P69156 (Sequence in FASTA format)
Description	Pro-MCH 2 precursor [Contains: Neuropeptide-glutamic acid-valine (NEV)(Neuropeptide E-V); Melanin-concentrating hormone (MCH)].
Source organism	Oncorhynchus tschawytscha (Chinook salmon) (King salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the melanin-concentrating hormone family.
Tissue Specificity	Pituitary gland. Produced in neurons of lateral basal hypothalamus which project both to the brain and to the neural lobe of the pituitary gland from where MCH is released
Post translational modification	N/A
Function	Plays a role in skin pigmentation by antagonizing the action of melanotropin alpha. Induces melanin concentration within the melanophores. May participate in the control of the hypothalamo-pituitary adrenal gland axis by inhibiting the release of ACTH
Protein Length	132 Amino acids
Molecular weight	14710
References	1  PubMed abstract 2471200
Domain Name	N/A
Hormone Name	Melanin-concentrating hormone
Mature Hormone Sequence	DTMRCMVGRVYRPCWEV
Position of mature hormone in Pre-Hormone protein	17 Residues from position (116-132)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10618
Swiss-prot Accession number	P69062 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain 2 precursor (Gonadotropin 2 alphachain) (GTH-alpha).
Source organism	Oncorhynchus tschawytscha (Chinook salmon) (King salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Involved in gametogenesis and steroidogenesis
Protein Length	114 Amino acids
Molecular weight	12538
References	1  PubMed abstract 7749461
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain 2
Mature Hormone Sequence	YPNSDKTNMGCEECTLKPNTIFPNIMQCTGCCFSRAYPTPLRSKQTMLVPKNITSEATCCVAKEGERVTTKDGFPVTNHTECHCSTCYYHKS
Position of mature hormone in Pre-Hormone protein	92 Residues from position (23-114)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10752
Swiss-prot Accession number	Q07221 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Oncorhynchus tschawytscha (Chinook salmon) (King salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation
Protein Length	210 Amino acids
Molecular weight	23892
References	1  PubMed abstract 1466911 2   Song S., Trinh K.T., Hew C.-L.; Yi Chuan Xue Bao 20:380-380(1993).
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	IENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDAYMSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL
Position of mature hormone in Pre-Hormone protein	188 Residues from position (23-210)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	11000
Swiss-prot Accession number	P69131 (Sequence in FASTA format)
Description	Prolactin-1 precursor (Prolactin I) (PRL-I).
Source organism	Oncorhynchus tschawytscha (Chinook salmon) (King salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	211 Amino acids
Molecular weight	23559
References	1  PubMed abstract 3349998
Domain Name	Hormone_1
Hormone Name	Prolactin-1
Mature Hormone Sequence	IGLSDLMERASQRSDKLHSLSTSLTKDLDSHFPPMGRVMMPRPSMCHTSSLQTPKDKEQALKVSENELISLARYLLLAWNDPLLLLSSEAPTLPHTPSNGDISSKIRELQDYSKSLGDGLDIMVNKMGPSSQYISSIPFKGGDLGNDKTSRLINFHFLMSCFRRDSHKIDSFLKVLRCRATNMRPETC
Position of mature hormone in Pre-Hormone protein	188 Residues from position (24-211)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated